PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G183100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 458aa    MW: 48826.3 Da    PI: 6.6406
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G183100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52.1e-154491148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+ Ed  l d v+ +G g+W+++ r+ g+ R++k+c++rw ++l
  Sobic.001G183100.1.p 44 KGPWTAAEDAMLMDHVRHHGEGNWNAVQRMTGLLRCGKSCRLRWTNHL 91
                          79******************************99***********996 PP

2Myb_DNA-binding51.13e-1697140146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +g+++++E++l++++++qlG++ W++ a++++ gRt++++k++w++
  Sobic.001G183100.1.p  97 KGSFSPDEELLIAQLHAQLGNK-WARMAAHLP-GRTDNEIKNYWNT 140
                           799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.6293991IPR017930Myb domain
SuperFamilySSF466891.65E-2843138IPR009057Homeodomain-like
SMARTSM007174.5E-134393IPR001005SANT/Myb domain
PfamPF002491.2E-134491IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-214598IPR009057Homeodomain-like
CDDcd001672.49E-104691No hitNo description
PROSITE profilePS5129422.71792146IPR017930Myb domain
SMARTSM007171.3E-1496144IPR001005SANT/Myb domain
PfamPF002493.2E-1597140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2499145IPR009057Homeodomain-like
CDDcd001677.37E-1199140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MEKSPGAAPT TSSPEEEEVA AEGHAHAEDV TDQEEERTPV VLKKGPWTAA EDAMLMDHVR  60
HHGEGNWNAV QRMTGLLRCG KSCRLRWTNH LRPNLKKGSF SPDEELLIAQ LHAQLGNKWA  120
RMAAHLPGRT DNEIKNYWNT RTKRRQRAGL PVYPPEVQLH LALSKRCRYD DFSPLSGTTN  180
VQALGAAASS AGYASSRPAP LDLARQLAVP NQQTVQFLSP APFSAPSSPW AKPFARNAQY  240
FQLAHSSPVS PSTPTGPMHP ATPDLSLGYG VRSAADQSRL PPLSPSPGPR VELPSNQYAQ  300
PTPPTSAAAA TSTGLGGGVA LPDHQNAASL EKMLQELHDV IKVDPPPALV PANGGVGSAA  360
MERHDGGVPE NNRFSGVQHR VDNDMDTLFG LVHPALSAPE TVPPAAASNH SGSTSQHSSD  420
DQNPSTVDLH VAGGTSSSDQ DWGLDGVCQW SNMSRIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-284214525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425370.0BT042537.1 Zea mays full-length cDNA clone ZM_BFb0325G13 mRNA, complete cds.
GenBankKJ7275320.0KJ727532.1 Zea mays clone pUT5392 MYB transcription factor (MYB129) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466889.10.0hypothetical protein SORBIDRAFT_01g015920
TrEMBLC5WUA40.0C5WUA4_SORBI; Putative uncharacterized protein Sb01g015920
STRINGSb01g015920.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-65myb domain protein 101